PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf00500g02026.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family NF-YB
Protein Properties Length: 549aa    MW: 59942.6 Da    PI: 4.8021
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf00500g02026.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB51.42.6e-162652184
                     NF-YB 21 lPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplk 84
                              lP + ++++d+++++ +c +efi +++se+++ c+re+++ti+++ +l al  lGf +y+e++ 
  Peinf101Scf00500g02026.1  2 LPPDVRVARDTQDLLIDCCVEFINLISSESNEVCNREDKRTIAPEHVLKALEVLGFGEYIEEVY 65
                              8999********************************************************9874 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.105.0E-282111IPR009072Histone-fold
SuperFamilySSF471136.49E-263114IPR009072Histone-fold
PfamPF008081.2E-12452IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 549 aa     Download sequence    Send to blast
MLPPDVRVAR DTQDLLIDCC VEFINLISSE SNEVCNREDK RTIAPEHVLK ALEVLGFGEY  60
IEEVYGAYEQ HKLETMDTGR AGKSTNAAEM TEEEALAEQQ RMFAEARARM NGGVTVPPKQ  120
QDSESEQQRM LAEARARMNG GVTVPPKQQV SESEQPKMFA EAPARMNGGV TVPPKQQDSD  180
AEQQRMFAEA HASKNVGVTV PQQDALAEQQ RMFAEACASI NGGVTVPPKQ QDALAEQQRM  240
FAEACARMNG GVTVPPKQQD ALAEQQRMFA EACARMNGGV TVPPKQQDAL AEQQRMFAEA  300
CARMNGGVTV PPKQQDALAE QQRMFAEACA RMNGGVTVPP KQHDALAEQQ RMFAEACARM  360
NGGVTVPPKQ QDALAEQQRM FAEACARMNG GVTVPPKQQD ALAEQQRMFA EACARMNGGV  420
TVPPKQHDAL AEQQRMFAEA CARMNGGVTV PPKQQDALAE QQRMFAEACA RMNGGVTVSP  480
KQQDALAEQQ RLFAEAFARM NGSVTVIPKQ QDSEAEQQRM VAEARAGMNV GVTVPPKQQD  540
SEPEHNLNS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_B7e-25410730133Transcription Regulator NC2 beta chain
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754451e-46HG975445.1 Solanum pennellii chromosome ch06, complete genome.
GenBankHG9755181e-46HG975518.1 Solanum lycopersicum chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016471364.11e-141PREDICTED: protein Dr1 homolog
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA2489822
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23090.42e-60nuclear factor Y, subunit B13